PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Do009724.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Panicoideae; Panicodae; Paniceae; Dichantheliinae; Dichanthelium
Family TALE
Protein Properties Length: 221aa    MW: 25170.2 Da    PI: 6.8003
Description TALE family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Do009724.1genomeDichanView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox23.96.9e-081631962154
                 HSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHH CS
    Homeobox  21 knrypsaeereeLAkklgLterqVkvWFqNrRak 54 
                 k +yp++e++++L +++gL+ +q+ +WF N+R +
  Do009724.1 163 KWPYPTEEDKARLVQETGLQLKQINNWFINQRKR 196
                 569*****************************87 PP

2ELK31.34.4e-11117138122
         ELK   1 ELKhqLlrKYsgyLgsLkqEFs 22 
                 ELKh+L+++Y+++L+++++E++
  Do009724.1 117 ELKHELKQGYREKLVDIREEIM 138
                 9********************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM012568.5E-141161IPR005541KNOX2
PfamPF037912.1E-112260IPR005541KNOX2
SMARTSM011883.8E-4117138IPR005539ELK domain
PROSITE profilePS5121310.196117137IPR005539ELK domain
PfamPF037896.3E-7117138IPR005539ELK domain
PROSITE profilePS5007111.758137200IPR001356Homeobox domain
SMARTSM003893.3E-10139204IPR001356Homeobox domain
SuperFamilySSF466896.84E-16139204IPR009057Homeodomain-like
CDDcd000861.01E-11140201No hitNo description
Gene3DG3DSA:1.10.10.601.3E-24144201IPR009057Homeodomain-like
PfamPF059202.0E-18157196IPR008422Homeobox KN domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 221 aa     Download sequence    Send to blast
MAFHYPDHAL AMDPTAAAAG THYVLLLCSF KEQLQQHVRV HAMEAVMACW ELEQTLQSLT  60
GASPGEGTGA TMSDDEDNQV DSESNMFDGN EASDGMGFGP LMLTEGERSL VERVRQELKH  120
ELKQGYREKL VDIREEIMRK RRAGKLPGDT ASTLKAWWQA HSKWPYPTEE DKARLVQETG  180
LQLKQINNWF INQRKRNWHS NPASSSSDKS KRKRYGNEKL H
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1193213RKRNWHSNPASSSSDKSKRKR
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankFP0998780.0FP099878.1 Phyllostachys edulis cDNA clone: bphylf032a14, full insert sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004965737.11e-143PREDICTED: homeobox protein knotted-1-like 11 isoform X1
SwissprotQ0E3C31e-133KNOS2_ORYSJ; Homeobox protein knotted-1-like 2
TrEMBLK3XYC41e-143K3XYC4_SETIT; Uncharacterized protein
STRINGSi006932m1e-142(Setaria italica)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP56438169
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G25220.21e-118KNOTTED1-like homeobox gene 3